PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn366981
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family ARR-B
Protein Properties Length: 647aa    MW: 72932.7 Da    PI: 6.5724
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn366981genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.67.7e-25218271155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r++Wt +LH++Fv+av+q+ G +k  Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  Achn366981 218 KARVVWTVDLHQKFVKAVNQM-GFDKVGPKKILDLMNVPWLTRENVASHLQKYRL 271
                 68*******************.9*******************************8 PP

2Response_reg56.31.8e-196214626109
                   EEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
  Response_reg  26 vaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                    +++  + eal+ll+e++  +D+++ D++mp+mdG++ll++   e  +lp+i+++  ge + + + ++ Ga d+l Kp+ ++el++
    Achn366981  62 FTTCCLAIEALDLLRERKdgFDIVISDVNMPDMDGFKLLEHVGLEM-DLPVIMMSVDGETSRVMRGVQHGACDYLLKPIRMKELRN 146
                   5666667799****998889**********************6644.8***********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521723.13E-2816160IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.2E-3716159No hitNo description
SMARTSM004483.9E-2117148IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011035.97318152IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.12E-2320152No hitNo description
PfamPF000723.5E-1663147IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:1.10.10.603.1E-28216276IPR009057Homeodomain-like
SuperFamilySSF466898.24E-18216275IPR009057Homeodomain-like
TIGRFAMsTIGR015576.8E-22218271IPR006447Myb domain, plants
PfamPF002494.0E-8220270IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
METGFSSPRT DAFPAGLRVL VVDDDLAWLR ILEKMLKKCS YEANHIDTCL IYYLSSAKIL  60
TFTTCCLAIE ALDLLRERKD GFDIVISDVN MPDMDGFKLL EHVGLEMDLP VIMMSVDGET  120
SRVMRGVQHG ACDYLLKPIR MKELRNIWQH VFRKRIHEVR DIESHEGIDE IQMMRYGSDQ  180
FDDWHLLSGH DLTSGKKRRD VDSKHDDKDL GDHSSAKKAR VVWTVDLHQK FVKAVNQMGF  240
DKVGPKKILD LMNVPWLTRE NVASHLQKYR LYLSRLQKEN DLKASFGGIK QSDSSSKDPA  300
GNLSLPNSIK MQQNDSASGI YGMPGNKTLP QSVDQKIHES DLKGIVSLSV METKKAPIHD  360
IPDPSKVSSS RMVPNHPFGQ LEQEVKYARF NSSIPKQYAW SQVPEVQFKQ EHKIHHRVEN  420
GFNHLPLPGL QHHVQVDFIQ PTPSVSSRPF NKEREKPASI EIKPSYNNFS SHQTIQVAPI  480
GTATNLFPVQ SESYAISFHT PAPTLTATLS MKNHGLNQIF VNELESAQRN LISGNCSGFA  540
SSDGDLISCL LQGNSYATNV ELQNKESFNH NCPELFVETP TCLNDAQRFD YDYPWESMEY  600
PVIDQALSSH LKLKEEATAG GRALCPGATE SFKRLCSVEE NSDFLQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-18214276163ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ8229876e-49FJ822987.1 Vitis vinifera cytokinin B-type response regulator 5 (RRb5) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002267616.10.0PREDICTED: two-component response regulator ARR11
TrEMBLD7TAK20.0D7TAK2_VITVI; Putative uncharacterized protein
STRINGVIT_01s0010g02230.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA67882433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.11e-120response regulator 11